They don’t mix the ingredients, everything is separate. Peanuts are nasty. Found a piece of chicken in my vegan salad. Disgusted
John L.
Classificação do local: 1 Oakland, CA
If you respect your tastebuds, you will avoid this place like the plague. At the end of the day, my enjoyment of the food itself could supercede all other factors that go into a review, for good or bad. I had the warrior bowl, with chicken added. And it was awful.
Alexandra I.
Classificação do local: 5 San Francisco, CA
I REALLY liked the wrap I got. It was the Nija wrap and so good and fresh! Had a delicious asian dressing with won ton crisps in it. Really big for under $ 6. Will definitely come here again when I want to be healthy but don’t want a boring salad.
Ryan L.
Classificação do local: 1 San Francisco, CA
I’ve eaten here twice. The food is… ok. Unfortunately the latest time I got a burrito here… if you can call it that. I opened it up and it fell apart everywhere. The worst part? The food gave me food poisoning!
Kris B.
Classificação do local: 4 Toronto, Canada
We order lunch through Freshii about 2 times/week via seamless. The food is good, my fave being the Mediterranean bowl, with quinoa base and tofu or shrimp. What I really love about this place is their commitment to customer service. They forgot my order, and with a quick call to their office, they apologized for the mix up and offered to have the order made up fresh and delivered back here in 15 minutes.
Jinger s.
Classificação do local: 1 Seattle, WA
This place is terrible. 1 star is being generous. I ordered the Cobb salad WITHOUT cheese and when it arrived it had cheese. When I told the woman that my order was supposed to be without cheese, she replied saying ‘we didn’t put cheeder cheese on it’. Uh well blue cheese is still cheese last time I checked. Turns out instead of making a new salad she just removed the cheese from the original salad. I didn’t notice this until I got back to work, there were still bits of cheese and I was unable to eat part of my salad. I am very allergic to dairy so when I ask for no cheese I mean it. I will never go back to this place.
Lily Y.
Classificação do local: 3 San Francisco, CA
I’m not a regular FiDi gal so when it came to lunch time for work, I knew I wanted salad, but had no idea where to get one. Pulled out my trusty Unilocal app to find the closest place and popped up Freshii… sadly to find thIs place only had a 2 ½ star rating. Anyway… Focaccia had a super long line that wrapped around the shop, Fleur de Sel was three blocks away, and this place at least looked clean so I thought, why not? FOOD&TASTE: -«Superbiotic» salad contains spinach & romaine, corn, chickpeas, cucumbers, red onions, red bell peppers, artichokes, sun-dried tomatoes served with a cucumber-dill dressing [Ingredients were fresh, but taste was nothing spectacular. Felt a bit skimped on the dressing, that coming from a gal who uses dressing sparingly.] CONVENIENCE: *** [Located in the FiDi, one block from Market St., corner of Bush St., not convenient to get to unless in the area.] AMBIANCE: **** [Clean white walls & counter tops, clear menu on flat screen, bar seating against wall or window] SERVICE: **** [Fast & friendly, but cashier got my order wrong. Ordered a salad, but out came a wrap. Fast, easy fix.] PRICE: $ [$ 7.99 for salad price, but they charged me $ 6.99 as a wrap since they messed up my order.] OVERALL: *** [3-stars… decent salad, but lacks creativity. Not bad not great, but does the job. Rating is fair.] Nuff said. [#46 of 100 UnilocalCHALLENGE2013]
Minh T.
Classificação do local: 1 San Francisco, CA
Lunch with a coworker 12:30PM. No lines = uh oh. A friend from work asked me to try this place with him for lunch. I’ve seen this place for a year and never tried it myself, but I thought why not. So I did and I will never come back. Price: Varies, $ 7-$ 15+ Depending on what you want, most ciders average $ 7-$ 13. Service: The cashier recommended the best soup in the house. Spicy Noodles. NOT A GOODIDEA… Food — Terrible uncooked noodle that had a tasteless broth. Overall — I can’t judge them on any other food, but the soup was just plain terrible. TIPS: If you want good soup, try anywhere else. Recommended? No
Sunil R.
Classificação do local: 3 San Francisco, CA
OK option if you want a quick lunch. I had the chicken wrap which is more like a salad in a wrap.
Kurt P.
Classificação do local: 4 Oakland, CA
Had my 1st Freshii experience earlier today for lunch. Wasn’t planning on writing a review until I was surprised by the overall low rating on Unilocal when I checked this evening. Not sure if this location provided bad service and/or food before, but I had a positive and tasty experience today, and will try again at the Embarcadero location next week. Arrived at about 11:15AM and ordered the Ninja wrap and the Thai burrito, both with chicken added. There were three customers waiting for food when I came in, and a few came in while I waited for my food. Contrary to what others have written, both my wrap and burrito came out in about 4minutes, and both had chicken like I ordered. The man who took my order, and the young lady who handed me my food, were both friendly and smiled. The Ninja wrap was pretty good, but a bit too much of the sauce(a bit sweet); while the Thai wrap didn’t have enough of its sauce, so that I could barely taste the ‘Thai’ flavor(lemongrass). Next time, I’ll just order one with less sauce, and the other with more sauce. If you’re looking for filling and healthy food, give Freshii a try.
Christine B.
Classificação do local: 2 San Francisco, CA
Tried this place on a whim on my way back from running an errand. Wish I’d looked at Unilocal first! I ordered the Coconut Curry Soup and also received the pita chips and hummus. I try not to write bad reviews, but the soup was honestly kind of disgusting. It had a thick layer of oil on top so it was totally greasy. It was salty but also extremely bland — no trace of coconut, and the only hint of «curry» was that it was kind of spicy. Basically it tasted like greasy salty water with three small chunks of tofu — the opposite of fresh. I ended up throwing it out and just ate the pita chips and hummus, which were actually quite good. It’s too bad, I love so many of the things they offer — quinoa, kale, etc. — but based on this experience and all the other reviews I can’t see myself coming back.
Michelle P.
Classificação do local: 1 Mill Valley, CA
Don’t ask for a wrap wrapped in collard greens. It comes out incredibly tiny, and takes a long time too. As a testament to their customer service, they made up for it with a free entrée card, which made me feel better about the experience. Overall the food feels like raw ingredients cobbled together in an unfulfilling and small portion with unoriginal old-fashion dressing. Won’t be going back, not even to use the free entrée card…
Katie S.
Classificação do local: 2 San Francisco, CA
I generally try not to write negative reviews – it could always have been an off day. However, Freshii, I can take you no more. Every single time I visit, I pay to add chicken and my meal fails to ever have chicken in it. The«southwest» chicken soup is neither spicy nor southwestern in any sense of the word. It is hot water poured over broccoli and chunks of uncooked tomato. The pita chips never seem to make it into my bag – so I have hummus without any dipping apparatus, or the other way around(today, chips but no hummus). I ordered a wrap, I received a salad. To top it all off, it was the slowest lunch I have ever received considering I walked up with no line and had no one ahead of me. Nonetheless, the four people after me had come and gone before mine came up. I’m going to eat this, not because I want to, not because it tastes good(it does not) but because I am starving, and have no lunch-hour leftover within which to find a suitable replacement. Thank god I can still look forward to happy hour since lunch effectively sucks.
Saadullah S.
Classificação do local: 2 San Francisco, CA
The food can easily score 3.5 stars, its actually really good. However, the service here is beyond terrible. I have been here a few times and never have I been able to get my food in time, every single time I had to wait 40+ minutes just to get a rice bowl, even when it wasn’t that crowded. Seriously!!! Once came here with a colleague, and both of us ordered the exact same rice bowl. He got his in 10 minutes and we had to wait another 30 minutes for mine. They did however, give me a free meal card(which is why I went there after the first bad experience), but they fail to get their act together. Not even sure how they are still in business despite such a terrible service and then trying to please patrons with free meals.
Eric H.
Classificação do local: 2 Dallas, TX
Terrible. This location had tiny salads and lacked the customization that Freshiis are typically know for. Unlike the other Freshii I’ve been to in Houston, the portions are incredibly tiny. They don’t toss your salad for you, and there’s little room for add-ins or customized salads. For a $ 10 salad, I’ll take a nice, crisp salad from Specialties or Mixt Greens.
Zeel J.
Classificação do local: 3 San Diego, CA
So had the western chicken soup deal. My friend and I ordered it without cheese, but they didn’t get that right. It tasted okay, but nothing special.
Ed U.
Classificação do local: 2 San Francisco, CA
These workaday lunch places are all starting to look alike to me… Freshroll, Tava, Bamboo Asia, now Freshii. Too much alike if you ask me since they all seem to use the same Subway/Chipotle-tested formula of pick-and-choose in compiling whatever you order into something they deem edible and chargeable. I don’t think that’s necessarily true as there is a false presumption that all their ingredients are compatible with each other, for instance, at Tava, I ordered a lamb tikka sauce in a salad bowl, and the result was marginal at best. At least Freshii makes an attempt at organizing the ingredients in a way that allows you simply to select what protein you would like. Even with that head start, the result is still boring and quite unmemorable here. I tried the oddly priced $ 6.59 Lemongrass Boost bowl, which sounded like it had a Thai twist to a healthy-sounding mix. Instead, it was an infinitely bland concoction with rice noodles mixed with cucumbers, bean sprouts, green onions, carrots, ground peanuts and some sauce they claimed was spicy lemongrass. It was accompanied by cubes of virtually inedible poultry that tasted it was processed(see photo). The portion was strangely skimpy as well, but given the relative tastelessness of the dish, I guess that’s a moot point. Freshii is full of good intentions with its eco-friendly health focus, but the execution really doesn’t motivate me to return anytime soon. FOOD — 2 stars… bland leading the bland AMBIANCE — 2.5 stars… pre-packaged goodness SERVICE — 2 stars… pick it up yourself TOTAL — 2 stars… latest in a Chipotle-lite genre that appears to be proliferating
Aggy A.
Classificação do local: 4 Orinda, CA
So, a while back I posted a snarky and totally true review of Freshi in the Bush Street location. Since then I received a note from the«owner» saying they’ve made changes and inviting me to give it a try on them. Too bad I lost that message somewhere in the abyss, but I decided to try it anyway. I went to their Just Herman Plaza location in Embarcadero 1. And MANHAVETHEYMADEGREATCHANGES!!! Seriously, I have had their ninja wrap and a few of their salads now. My favorite is the Harvest Salad with chicken. It is the most delicious salad ever and I have it 3 – 4 days a week and never get sick of it. ITISSOOOOOOOOGOOOOD! It has beets, carrots, other deliciousness, chicken, and a yummy honey mustard dressing(can be swapped for something else). The best thing is that their salad containers are awesome for adding a your dressing, resealing and shaking that ish up for a nice even coat. I’m telling you, you have to try this freaking salad! You can also get it with shrimp or steak. Any of their options come with lots of tiny, diced fresh ingredients which I am a huge fan of. And I appreciate that the powers that be actually listened to their customers and made changes. That’s the kind of place that has staying power in the big city. All in all, my dozen or so experiences at the Justin Herman Plaza location have all been quick, friendly, and delicious. So yes, I’ve changed my tune.
Jane A.
Classificação do local: 2 San Francisco, CA
WHYDOESMYPITASMELLLIKEFEETANDTASTELIKECARDBOARD? (2 stars) Best seller item … MY A*S!!! Someone’s got poor judgement. Healthy foods are not always the best tasting. But establishments like this place should make it tastier. But then again, some places tend to fail us. This place is killing my healthy régime. I would have rather settled for something at McDees. Forgot my lunch at home and am forced to find something I don’t like in the FiDi to eat and pay more than its worth. Came to Freshii because I wanted to try something new and healthy. Decided to try one of the items that had«best seller» item next to it. What a mistake. HEFFER-STYLESTATUS. ICEWATER(free) — why is an establishment like this promoting«healthiness» when they server tap water. Who they trying to fool? Plain tap water in a to-go cup PITABREAD(free) — was asked if i wanted pita bread with my salad. why not! As i took my first bite, it smells like feet and tasted like cardboard. blah!!! WILDPACIFICSALMONSALAD($ 9.99) — Okay, the two stars in itself is for the salmon and mandariin. But the rest of the salad, total failure. It comes with spinich, mushrooms, roasted, red bellpepper, good sized salmon, cucumbers, mandarin oranges and with cucumber dill dressing. One of the blandest(is that even a word) salad’s i’ve ever tasted. And for the price i paid, totally not worth it. Failure!!! 1) where’s the cucumber? i found zero cucumbers in my salad 2) roasted red bell pepper? my bell peppers weren’t roasted 3) mushrooms — blah. too much in my salad. 4) cucumber dill dressing? tasted like nothing. 5) salad was complete BLAND Pass 1) One star — the piece of salmon resting on my salad. had to break it up and eat some chunks with the salad to help assist the blank salad go down 2) Another star — mandarin oranage helped with some flavoring in the salad Should have stuck with my instinct of getting the lemon grass soup(in other words, phở). But after tasting the broth and looking outside, it was too sunny for soup. Will I be back? Yes, to try the Lemon Grass Soup because the broth was mighty tasty when I sampled it. Otherwise, this place can kiss it. Until the next review…
Jennifer C.
Classificação do local: 4 Carlsbad, CA
Came here with some co-workers before reading any Unilocal reviews. The reception on my iPhone is always so slow in SF that I wasn’t able to look up this place on Unilocal before I ordered anything. Looking at the menu, the Bangkok burrito caught my eye. It’s a Thai inspired burrito with brown rice, carrots, cucumbers, bean sprouts, mushrooms, and chicken with a spicy peanut sauce, wrapped in a honey wheat tortilla. So after I placed my order, my phone starts working and i was disappointed to see that Freshii only had 2.5 stars on Unilocal.Hopefully i can help with bringing that up because the burrito was actually quite good. Not only was it good, it was also large and filling and most importantly, HEALTHY. So there’s this nifty calorie calculator on Freshii’s website: and my burrito was less than 500 calories. The price was not bad also: $ 8.20 after tax. My only gripe was that they forgot to include cucumbers in my burrito. By the time i noticed all the specs of green in my co-worker’s burrito, I had already eaten ¾ of my burrito and didn’t think it was worth it to complain. I’ve also read other Unilocal reviewers complaining about the order form they had to fill out, but I just walked up and one of the employees filled it out for me. No complaints there. The service was fast and speedy. I was done with lunch in less than 30 minutes.